PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BS_BCC406654.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 808aa    MW: 92737.4 Da    PI: 5.1621
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BS_BCC406654.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR178.71.1e-2494181291
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                             Y+eY++++GFsvrk k+++ + ++ i +++++Cskeg +++e+ +  +++ +++etrt+Cka+++ + +++g+w+v+++  eHnHel
  Traes_5BS_BCC406654.2  94 LYCEYGHRMGFSVRKGKQYYFTGTKVIRTKDYYCSKEGLKDDEQLT--EANFNKPETRTNCKAMVRFRVDSEGQWRVIQIIPEHNHEL 179
                            7*****************************************9988..9999************************************ PP

                   FAR1  90 ap 91 
                            +p
  Traes_5BS_BCC406654.2 180 VP 181
                            86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.0E-2294181IPR004330FAR1 DNA binding domain
PfamPF105518.4E-31292386IPR018289MULE transposase domain
PROSITE profilePS509669.619573609IPR007527Zinc finger, SWIM-type
PfamPF044341.6E-5575602IPR007527Zinc finger, SWIM-type
SMARTSM005751.7E-7584611IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 808 aa     Download sequence    Send to blast
EGTSVPIEID GDAICLENVG DDEHEAQESG QVQIIYATEN GAQVAFDSQE QGTEEHSVRS  60
EEDQENNSVI PSREEFTEEL RTKVAYSEEQ AYRLYCEYGH RMGFSVRKGK QYYFTGTKVI  120
RTKDYYCSKE GLKDDEQLTE ANFNKPETRT NCKAMVRFRV DSEGQWRVIQ IIPEHNHELV  180
PPEEIHLLRS VRILSIPKPG TLNAMVNAEI QSMHDSLHVH DDGAECHSQV SIQSYALLEP  240
EDAEALVGYL KRRTIEQGMF YWDVQVDQEG QMTNFFWRDG RSRVDYDCFG DVVVFDTSYR  300
TNKYNMICAP FVGINHHMQN VMFGCAFMLD ESLTSYEWLL KSFLESMGGC PPKTIFTDQN  360
DTISKAIEVI LPETRHCICQ WHIEKNLQAH LDTPNASGTF HSMFMKCMKG CESEAEFEET  420
WAMMLQEHNL QDDQWLTDLF EQRHKWCTAL HKVAFDCGIR SLDRNFSSHN VLGSIADEST  480
SPTNFALEFD KLVGSWRTNE SVDDIQCKQI SPECSVKQNS ILQHAAEVYT HKVYKSLETE  540
FLDGCTGTSY QEMQCSETLY RFEFIMQSSP KVWIVFLDTS TMELSCSCKK FEMMGILCSH  600
ALNALGLKNL DKIPESYVLK RWTKYVRKGT YVFPSDQSPE QDCTEAVLAY RNRAMWFVYD  660
LLMKSKRHQD TRKLILDVLE NGEKSLESVC ELKRMHIHPS GKDKDASKAE KRKKKLSKQD  720
KNSRNVKQVV LPPPAESVFV DQPNQNQYFA TEDIATNSSI GRPFFYQEYP ATGVSASQIE  780
GHANIHSVPQ CAPAPQLCCL LRYIHQTS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3584850.0AK358485.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1077H06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578884.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLW5FNQ00.0W5FNQ0_WHEAT; Uncharacterized protein
STRINGMLOC_62808.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.13e-82FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]